PE Rabbit anti-Mouse CD272/BTLA monoclonal antibody

Größe

Auf Anfrage

SKU:: A26260
Zusätzliche Namen:: A630002H24
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EKATKRNDEECPVQLTITRNSKQSARTGELFKIQCPVKYCVHRPNVTWCKHNGTICVPLEVSPQLYTSWEENQSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLITVSDIPDATNASGPSTMEERP
Uniprot:: Q7TSA3
Synonyme:: A630002H24;B- and T-lymphocyte attenuator;B- and T-lymphocyte-associated protein;BTLA1;CD272
Weitere Details:: Enables signaling receptor activity. Acts upstream of or within immune response-regulating cell surface receptor signaling pathway; negative regulation of B cell proliferation; and negative regulation of alpha-beta T cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Orthologous to human BTLA (B and T lymphocyte associated).