CD137 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A26248
Zusätzliche Namen:: 4-1BB|A930040I11Rik|Cd137|CDw137|ILA|Ly63
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 24-28kDa/40-50kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL
Uniprot:: P20334
Synonyme:: 4-1BB;4-1BB ligand receptor;A930040I11Rik;AA408498;AI325004;CD137;CD137 antigen;CDw137;homolog of mouse 4-1BB;ILA;induced by lymphocyte activation (ILA);interleukin-activated receptor, homolog of mouse Ly63;Ly6;Ly63;receptor protein 4-1BB;secreted CD137 antigen;T cell antigen ILA;T-cell antigen 4-1BB;T-cell antigen 4-1BB homolog;tumor necrosis factor receptor superfamily member 9
Weitere Details:: Enables cytokine binding activity; identical protein binding activity; and signaling receptor activity. Acts upstream of or within negative regulation of interleukin-10 production; negative regulation of interleukin-12 production; and regulation of cell population proliferation. Located in external side of plasma membrane and extracellular space. Is expressed in renal vasculature. Orthologous to human TNFRSF9 (TNF receptor superfamily member 9).

Versandbedingungen:: Blue Ice