[KD Validated] VDAC3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A26244
Zusätzliche Namen:: HD-VDAC3|VDAC-3
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 31kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLD
Uniprot:: Q9Y277
Synonyme:: HD-VDAC3;outer mitochondrial membrane protein porin 3;VDAC-3;voltage-dependent anion-selective channel protein 3
Weitere Details:: This gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kinases of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Alternatively transcript variants encoding different isoforms have been described for this gene.