A26198
CD11b Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A26198
- Zusätzliche Namen:
- CD11B|CR3A|MAC-1|MAC1A|MO1A|SLEB6
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 170kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPP
- Uniprot:
- P11215
- Synonyme:
- antigen CD11b (p170);CD11 antigen-like family member B;CD11B;cell surface glycoprotein MAC-1 subunit alpha;complement component 3 receptor 3 subunit;CR-3 alpha chain;CR3A;integrin alpha-M;integrin, alpha M (complement component 3 receptor 3 subunit);leukocyte adhesion receptor MO1;MAC-1;MAC1A;macrophage antigen alpha polypeptide;macrophage-1 antigen alpha subunit;MO1A;Neutrophil adherence receptor;neutrophil adherence receptor alpha-M subunit;SLEB6
- Weitere Details:
- This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice