Cleaved PARP1 p25 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A26155
Zusätzliche Namen:: ADPRT|ADPRT 1|ADPRT1|ARTD1|pADPRT-1|PARP|PARP-1|PARS|Poly-PARP|PPOL
Anwendung:: ELISA, WB
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
Uniprot:: P09874
Synonyme:: ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase);ADP-ribosyltransferase diphtheria toxin-like 1;ADP-ribosyltransferase NAD(+);ADPRT;ADPRT 1;ADPRT1;ARTD1;DNA ADP-ribosyltransferase PARP1;NAD(+) ADP-ribosyltransferase 1;pADPRT-1;PARP;PARP-1;poly (ADP-ribose) polymerase family, member 1;poly [ADP-ribose] polymerase 1;poly(ADP-ribose) synthetase;poly(ADP-ribosyl)transferase;poly[ADP-ribose] synthase 1;PPOL;protein poly-ADP-ribosyltransferase PARP1
Weitere Details:: This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes.

Versandbedingungen:: Blue Ice