A26154
ZNF683 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A26154
- Zusätzliche Namen:
- Hobit,ZNF683
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 57kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HSGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYDIDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN
- Uniprot:
- Q8IZ20
- Synonyme:
- Hobit;homolog of Blimp-1 in T cells;homolog of Blimp-1 in T-cell;hypothetical protein MGC33414;tissue-resident T-cell transcription regulator protein ZNF683;Zinc finger protein 683
- Weitere Details:
- Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in T cell receptor signaling pathway; cellular response to ionomycin; and regulation of gene expression. Predicted to be located in nucleus.
- Versandbedingungen:
- Blue Ice