ABflo[R] 647 Rabbit anti-Human KLRG1 PolymAb[R]

Größe

£342.00

SKU:: A26141PM
Zusätzliche Namen:: 2F1|CLEC15A|MAFA|MAFA-2F1|MAFA-L|MAFA-LIKE
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Uniprot:: Q96E93
Synonyme:: 2F1;C-type lectin domain family 15 member A;CLEC15A;ITIM-containing receptor MAFA-L;killer cell lectin-like receptor subfamily G member 1;killer cell lectin-like receptor subfamily G, member 1;MAFA;MAFA-2F1;MAFA-L;MAFA-LIKE;MAFA-like receptor;Mast cell function-associated antigen;mast cell function-associated antigen (ITIM-containing)
Weitere Details:: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to t