A26137
CD123 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A26137
- Zusätzliche Namen:
- CD123|CDw123|SUT-1
- Anwendung:
- ELISA, Flow Cytometry
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK
- Uniprot:
- P26952
- Synonyme:
- CD123;CD123 antigen;CDw123;hIL-3Ra;Il-3 alpha subunit;IL-3 receptor alpha chain;IL-3 receptor subunit alpha;IL-3R subunit alpha;IL-3R-alpha;IL-3RA;IL3R;IL3RAY;IL3RX;IL3RY;interleukin 3 receptor, alpha (low affinity);interleukin-3 receptor class II alpha chain;interleukin-3 receptor subunit alpha;SUT-;SUT-1
- Weitere Details:
- Enables interleukin-3 binding activity and interleukin-3 receptor activity. Acts upstream of or within interleukin-3-mediated signaling pathway; monocyte differentiation; and regulation of cell growth. Located in membrane. Is expressed in several structur
- Versandbedingungen:
- Blue Ice