A2612
Gelsolin Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A2612
- Zusätzliche Namen:
- ADF|AGEL|Gelsolin
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 86kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQ
- Uniprot:
- P06396
- Synonyme:
- actin-depolymerizing factor;ADF;AGEL;brevin;epididymis secretory sperm binding protein;gelsolin
- Weitere Details:
- The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice