CD93 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A26060
Zusätzliche Namen:: 6030404G09Rik|AA4.1|C1qr1|C1qrp|Ly68
Anwendung:: ELISA, Flow Cytometry, IF, ICC
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ADSQAVVCEGTACYTAHWGKLSAAEAQHRCNENGGNLATVKSEEEARHVQQALTQLLKTKAPLEAKMGKFWIGLQREKGNCTYHDLPMRGFSWVGGGEDTAYSNWYKASKSSCIFKRCVSLILDLSLTPHPSHLPKWHESPCGTPEAPGNSIEGFLCKF
Uniprot:: O89103
Synonyme:: 6030404G09Rik;AA145088;AA4;AA4.1;AW555904;C1q;C1q receptor 1;C1q/MBL/SPA receptor;C1qr;C1qR(p);C1qr1;C1qrp;CD93 antigen;CDw93;cell surface antigen AA4;complement component 1 q subcomponent receptor 1;complement component 1, q subcomponent, receptor 1;complement component C1q receptor;dJ737E23.1;ECSM3;ly-68;Ly6;Ly68;lymphocyte antigen 68;matrix-remodeling-associated protein 4;matrix-remodelling associated 4;MXRA4
Weitere Details:: Predicted to enable complement component C1q complex binding activity. Predicted to be involved in cell-cell adhesion. Predicted to act upstream of or within cell adhesion. Located in cell surface; cytoplasmic vesicle; and plasma membrane. Is expressed in blood vessel. Orthologous to human CD93 (CD93 molecule).