PE Rabbit anti-Mouse CD196/CCR6 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26056
Zusätzliche Namen:: CC-CKR-6|CCR-6|Cmkbr6|KY411
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTK
Uniprot:: O54689
Synonyme:: BN-1;C-C chemokine receptor type 6;C-C CKR-6;CC-CKR-6;CCR-6;CD196;chemokine (C-C motif) receptor 6;chemokine (C-C) receptor 6;chemokine receptor-like 3;CKR-L3;CKRL3;Cmkbr;CMKBR6;DCR2;DRY6;G protein-coupled receptor 29;GPR29;GPRCY4;KY411;LARC receptor;seven-transmembrane receptor, lymphocyte, 22;STRL22
Weitere Details:: Enables C-C chemokine binding activity and C-C chemokine receptor activity. Involved in several processes, including immune system development; leukocyte migration; and regulation of cell motility. Located in external side of plasma membrane; sperm plasma membrane; and sperm principal piece. Is expressed in several structures, including central nervous system; gut; immune system; male reproductive gland or organ; and retina. Orthologous to human CCR6 (C-C motif chemokine receptor 6).