A2605
SYVN1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A2605
- Zusätzliche Namen:
- DER3|HRD1|SYVN1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 68kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDA
- Uniprot:
- Q86TM6
- Synonyme:
- DER3;E3 ubiquitin-protein ligase synoviolin;HMG-coA reductase degradation 1 homolog;HRD1;RING-type E3 ubiquitin transferase synoviolin;Synovial apoptosis inhibitor 1;synovial apoptosis inhibitor 1, synoviolin
- Weitere Details:
- This gene encodes a protein involved in endoplasmic reticulum (ER)-associated degradation. The encoded protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins. Sequence analysis identified two transcript variants that encode different isoforms.
- Versandbedingungen:
- Blue Ice