APC Rabbit anti-Mouse CD138/Syndecan-1 monoclonal antibody

Größe

Auf Anfrage

SKU:: A26049
Zusätzliche Namen:: CD138|CD138/Syndecan-1|Sstn|syn-1|Synd|Synd1
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKEVLG
Uniprot:: P18828
Synonyme:: AA408134;AA409076;CD138;CD138 antigen;heparan sulfate proteoglycan fibroblast growth factor receptor;SDC;Sstn;Sy;Syn;syn-1;Synd;SYND1;syndecan;syndecan proteoglycan 1;syndecan-1;synstatin
Weitere Details:: Predicted to enable identical protein binding activity and protein C-terminus binding activity. Involved in myoblast development. Acts upstream of or within canonical Wnt signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; egg cylinder; sensory organ; skin; and urinary system. Orthologous to human SDC1 (syndecan 1).