[KD Validated] AARS2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A25997
Zusätzliche Namen:: AARSL|COXPD8|LKENP|MT-ALARS|MTALARS
Anwendung:: ELISA, WB
Molekulargewicht:: 107kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GLWLDVHALGELQRQGVPPTDDSPKYNYSLRPSGSYEFGTCEAQVLQLYTEDGTAVASVGKGQRCGLLLDRTNFYAEQGGQASDRGYLVRAGQEDVLFPVARAQVCGGFILHEAVAPECLRLGDQVQLHV
Uniprot:: Q5JTZ9
Synonyme:: AARSL;alanine tRNA ligase 2, mitochondrial (putative);alanine--tRNA ligase, mitochondrial;Alanyl-tRNA synthetase;alanyl-tRNA synthetase 2, mitochondrial (putative);alanyl-tRNA synthetase like;COXPD8;LKENP;MT-ALARS;MTALARS;probable alanyl-tRNA synthetase, mitochondrial
Weitere Details:: The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. Aminoacyl-tRNA synthetases play critical roles in mRNA translation by charging tRNAs with their cognate amino acids. The encoded protein is a mitochondrial enzyme that specifically aminoacylates alanyl-tRNA. Mutations in this gene are a cause of combined oxidative phosphorylation deficiency 8.