[KD Validated] COX7A2L Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25980
Zusätzliche Namen:: COX7AR|COX7RP|EB1|SCAF1|SCAFI|SIG81
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Uniprot:: O14548
Synonyme:: COX7a-related protein;COX7AR;COX7RP;cytochrome c oxidase subunit 7A-related protein, mitochondrial;cytochrome c oxidase subunit VII-related protein;cytochrome c oxidase subunit VIIa polypeptide 2 like;cytochrome c oxidase subunit VIIa-related protein;EB1;estrogen receptor binding CpG island;SCAF1;SCAFI;SIG81
Weitere Details:: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene.

Versandbedingungen:: Blue Ice