RHOT2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2597
Zusätzliche Namen:: ARHT2|C16orf39|MIRO-2|MIRO2|RASL|RHOT2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPA
Uniprot:: Q8IXI1
Synonyme:: ARHT2;C16orf39;MIRO-2;MIRO2;mitochondrial Rho (MIRO) GTPase 2;mitochondrial Rho GTPase 2;Ras homolog gene family member T2;ras homolog gene family, member T2;RASL
Weitere Details:: This gene encodes a member of the Rho family of GTPases. The encoded protein is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics.