PE Rabbit anti-Mouse CD267/TACI monoclonal antibody

Größe

Auf Anfrage

SKU:: A25965
Zusätzliche Namen:: 1200009E08Rik|Taci
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT
Uniprot:: Q9ET35
Synonyme:: 1200009E08Rik;CD267;CVID;CVID2;IGAD2;RYZN;Ta;TACI;TNFRSF14B;transmembrane activator and calcium-modulating and cyclophilin ligand interactor;transmembrane activator and CAML interactor;tumor necrosis factor receptor 13B;tumor necrosis factor receptor superfamily member 13B
Weitere Details:: Acts upstream of or within B cell homeostasis; hematopoietic progenitor cell differentiation; and negative regulation of B cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in renal vasculature. Used to study systemic lupus erythematosus. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13B (TNF receptor superfamily member 13B).