GM-CSF Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25953
Zusätzliche Namen:: CSF|Csfgm|Gm-CSf|GMCSF|MGI-IGM
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 20-35kDa (Recombinant Protein)
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Uniprot:: P01587
Synonyme:: colony stimulating factor 2 (granulocyte-macrophage);colony-stimulating factor;CSF;Csfg;Csfgm;Gm-CS;Gm-CSf;GMCS;GMCSF;granulocyte macrophage-colony stimulating factor;granulocyte-macrophage colony stimulating factor 2;granulocyte-macrophage colony-stimulating factor;MGI-I;MGI-IGM;molgramostim;molgramostin;put. GM-CSF;sargramostim
Weitere Details:: Enables cytokine activity. Acts upstream of or within several processes, including embryonic placenta development; myeloid leukocyte differentiation; and positive regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including genitourinary system; hemolymphoid system; labyrinthine zone; liver; and lung. Used to study pulmonary alveolar proteinosis. Human ortholog(s) of this gene implicated in acute myeloid leukemia; juvenile myelomonocytic leukemia; neutropenia; pulmonary alveolar proteinosis; and visceral leishmaniasis. Orthologous to human CSF2 (colony stimulating factor 2).

Versandbedingungen:: Blue Ice