[KO Validated] KEAP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25951
Zusätzliche Namen:: INrf2|KLHL19
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 60-70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC
Uniprot:: Q14145
Synonyme:: cytosolic inhibitor of Nrf2;INrf2;KEAP1 delta C;kelch-like ECH-associated protein 1;kelch-like family member 19;kelch-like protein 19;KLHL19
Weitere Details:: This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.