CD252 (OX40 Ligand) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25928
Zusätzliche Namen:: Ath-1|Ath1|CD134L|gp34|OX-40L|Ox40l|Tnlg2b|TXGP1|Txgp1l
Anwendung:: ELISA, Flow Cytometry, IF, ICC
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Uniprot:: P43488
Synonyme:: Ath;Ath-;Ath-1;Ath1;atherosclerosis 1;CD134;CD134 ligand;CD134L;CD252;glycoprotein Gp34;gp3;GP34;OX-40L;OX4;OX40 antigen ligand;OX40 ligand;Ox40l;OX4OL;tax-transcriptionally activated glycoprotein 1 (34kD);tax-transcriptionally activated glycoprotein 1 ligand;TNLG2B;tumor necrosis factor (ligand) superfamily member 4;tumor necrosis factor ligand 2B;tumor necrosis factor ligand superfamily member 4;tumor necrosis factor superfamily member 4;Txgp;TXGP1;Txgp1l
Weitere Details:: Enables tumor necrosis factor receptor binding activity. Involved in several processes, including T cell activation; regulation of gene expression; and regulation of lymphocyte activation. Acts upstream of or within cholesterol metabolic process; inflammatory response; and negative regulation of cytokine production. Predicted to be located in cell surface. Predicted to be active in extracellular space. Is expressed in sensory organ and skeleton. Used to study primary pulmonary hypertension and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human TNFSF4 (TNF superfamily member 4).

Versandbedingungen:: Blue Ice