APC Rabbit anti-Mouse NK1.1/CD161c monoclonal antibody

Größe

Auf Anfrage

SKU:: A25913
Zusätzliche Namen:: CD161|Klrb1b|ly-55c|Ly-59|Ly55c|Ly59|Nk-1|Nk-1.2|NK-RP1|Nk1|NK1.1|Nk1.2|NKR-P1.9|NKRP1|NKRP140|Nkrp1b|Nkrp1c
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
Uniprot:: P27814
Synonyme:: AI462337;C-type lectin domain family 5 member B;CD161;CD161 antigen-like family member C;CLEC5B;hNKR-P1A;killer cell lectin-like receptor subfamily A member 1C;killer cell lectin-like receptor subfamily B member 1;killer cell lectin-like receptor subfamily B member 1C;killer cell lectin-like receptor subfamily B, member 1;Klrb1b;Ly-5;ly-55c;Ly-59;Ly5;Ly55;Ly55c;Ly59;lymphocyte antigen 55 complex, locus C;lymphocyte antigen 55c;lymphocyte antigen 59;natural killer cell receptor protein NKR-P1C;natural killer cell receptor-P1;natural killer cell surface protein P1-40;natural killer cell surface protein P1A;natural killer cell-associated antigen 1;Nk;NK-;Nk-1;NK-1.;Nk-1.2;NK-RP1;Nk1;Nk1.;NK1.1;Nk1.2;NKR;NKR-;NKR-P1;NKR-P1 40;NKR-P1.9;NKR-P1A;NKR-P1B;NKR-P1C;Nkrp;NKRP1;NKRP140;NKRP1A;Nkrp1b;Nkrp1c
Weitere Details:: Enables identical protein binding activity and signaling receptor activity. Acts upstream of or within natural killer cell activation and positive regulation of natural killer cell mediated cytotoxicity. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in thymus primordium. Orthologous to human KLRB1 (killer cell lectin like receptor B1).

Versandbedingungen:: Blue Ice