A25887
Nanog Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A25887
- Zusätzliche Namen:
- 2410002E02Rik|ecat4|ENK|Stm1
- Anwendung:
- ChIP, ELISA, Flow Cytometry, WB
- Molekulargewicht:
- 35-42kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI
- Uniprot:
- Q80Z64
- Synonyme:
- 2410002E02Rik;early embryo specific expression NK family;early embryo specific expression NK-type homeobox protein;ecat;ecat4;EN;ENK;ES cell-associated protein 4;homeobox protein NANOG;homeobox transcription factor Nanog;homeobox transcription factor Nanog-delta 48
- Weitere Details:
- The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice