[KD Validated] POLR2L Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25872
Zusätzliche Namen:: hRPB7.6|RBP10|RPABC5|RPB10|RPB10beta|RPB7.6
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 8kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: A synthetic peptide corresponding to a sequence within amino acids 1-67 of human POLR2L (NP_066951.1).
Formulierung:: Unmodified
Sequenz:: MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Uniprot:: P62875
Synonyme:: DNA-directed RNA polymerase III subunit L;DNA-directed RNA polymerases I, II, and III subunit RPABC5;hRPB7.6;polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa;polymerase (RNA) II subunit L;RBP10;RNA polymerase II 7.6 kDa subunit;RNA polymerase II subunit L;RNA polymerases I, II, and III subunit ABC5;RPABC5;RPB10;RPB10 homolog;RPB10beta;RPB7.6
Weitere Details:: This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases.