ABflo[R] 488 Rabbit anti-Mouse CD226/DNAM-1 monoclonal antibody

Größe

Auf Anfrage

SKU:: A25862
Zusätzliche Namen:: DNAM-1|DNAM1|Pta1|TLiSA1
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Uniprot:: Q8K4F0
Synonyme:: adhesion glycoprotein;BC051526;CD226 antigen;DNA;DNAM;DNAM-1;DNAM1;DNAX accessory molecule-1;platelet and T cell activation antigen 1;Platelet and T-cell activation antigen 1;Pt;PTA1;T lineage-specific activation antigen 1 antigen;TL;TLiSA1
Weitere Details:: Predicted to enable integrin binding activity and protein kinase binding activity. Acts upstream of or within positive regulation of interferon-gamma production and positive regulation of natural killer cell cytokine production. Located in external side of plasma membrane. Is expressed in embryo. Orthologous to human CD226 (CD226 molecule).