ABflo[R] 488 Rabbit anti-Human CD34 monoclonal antibody

Größe

Auf Anfrage

SKU:: A25855
Zusätzliche Namen:: CD34|CD34 molecule|GIG3|MORT1
Anwendung:: Flow Cytometry, IF, ICC
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
Uniprot:: P28906
Synonyme:: CD34 antigen;hematopoietic progenitor cell antigen CD34
Weitere Details:: Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region. Is expressed in several structures, including alimentary system; cardiovascular system; extraembryonic component; genitourinary system; and skin. Orthologous to human CD34 (CD34 molecule).