A25849
CCR7 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A25849
- Zusätzliche Namen:
- CC-CKR-7|CCR-7|CD197|Cdw197|Cmkbr7|EBI1|Ebi1h
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 43-50kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLVSAQVEALITIQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCETSKQLNIAYDV
- Uniprot:
- P47774
- Synonyme:
- BLR2;Bukitt's lymphoma receptor 2;C-C chemokine receptor type 7;CC chemokine receptor 7;CC-CKR-7;CCR-7;CD197;CDw197;chemokine (C-C motif) receptor 7;chemokine (C-C) receptor 7;Cmkbr;CMKBR7;EBI;EBI1;Ebi1h;EBV-induced G protein-coupled receptor 1;EBV-induced G-protein coupled receptor 1;Epstein-Barr virus induced gene 1;Epstein-Barr virus-induced G-protein coupled receptor 1;lymphocyte-specific G protein-coupled peptide receptor;MIP-3 beta receptor
- Weitere Details:
- Enables C-C chemokine receptor activity. Involved in several processes, including positive regulation of immune response; positive regulation of leukocyte chemotaxis; and regulation of cytokine production. Acts upstream of or within chemotaxis; homeostasis of number of cells; and immune response. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; immune system; reproductive system; and white fat. Used to study Sjogren's syndrome. Orthologous to human CCR7 (C-C motif chemokine receptor 7).
- Versandbedingungen:
- Blue Ice

