CCL4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25848
Zusätzliche Namen:: Act-2|AT744.1|MIP-1B|Mip1b|Scya4
Anwendung:: ELISA, WB
Molekulargewicht:: 12kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Uniprot:: P14097
Synonyme:: Act-;Act-2;ACT2;AT744.;AT744.1;C-C motif chemokine 4;chemokine (C-C motif) ligand 4;G-26;G-26 T-lymphocyte-secreted protein;HC21;immune activation protein 2;LAG-1;LAG1;lymphocyte activation gene 1 protein;macrophage inflammatory protein 1-beta;Mip;MIP-;MIP-1-beta;MIP-1-beta(1-69);MIP-1B;MIP1B;MIP1B1;PAT 744;Protein H400;Scy;SCYA2;SCYA4;secreted protein G-26;SIS-gamma;small inducible cytokine A4 (homologous to mouse Mip-1b);small-inducible cytokine A4;T-cell activation protein 2
Weitere Details:: Predicted to enable chemokine receptor binding activity and identical protein binding activity. Acts upstream of or within cellular response to xenobiotic stimulus. Located in extracellular space. Is expressed in central nervous system; genitourinary system; and retina. Human ortholog(s) of this gene implicated in acquired immunodeficiency syndrome and human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL4L2 (C-C motif chemokine ligand 4 like 2).

Versandbedingungen:: Blue Ice