A25812
Bcl-2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A25812
- Zusätzliche Namen:
- Bcl-2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 26 kDa
- Spezies-Reaktivität:
- Rat
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Spezies:
- Rat
- Sequenz:
- MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDD
- Uniprot:
- P49950
- Synonyme:
- apoptosis regulator Bcl-2;B cell lymphoma 2 associated oncogene;B-cell CLL/lymphoma 2;B-cell leukemia/lymphoma 2;Bcl-2;Bcl-2alpha;Bcl2-like protein;PPP1R50;protein phosphatase 1, regulatory subunit 50
- Weitere Details:
- Enables BH domain binding activity. Involved in several processes, including response to peptide; response to purine-containing compound; and response to vitamin. Located in cytosol; mitochondrial crista; and perinuclear region of cytoplasm. Used to study several diseases, including brain ischemia (multiple); end stage renal disease; gastric ulcer; intestinal disease (multiple); and status epilepticus. Biomarker of several diseases, including abdominal obesity-metabolic syndrome 1; brain disease (multiple); hypertension (multiple); intrinsic cardiomyopathy (multiple); and neurodegenerative disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); hematologic cancer (multiple); intracranial aneurysm; prostate cancer; and urinary bladder cancer. Orthologous to human BCL2 (BCL2 apoptosis regulator).
- Versandbedingungen:
- Blue Ice