NRP2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2581
Zusätzliche Namen:: NP2|NPN2|NRP2|PRO2714|VEGF165R2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGI
Uniprot:: O60462
Synonyme:: neuropilin-2;neuropilin-2a(17);neuropilin-2a(22);neuropilin-2b(0);NP2;NPN2;PRO2714;receptor for VEGF165 and semaphorins class3;vascular endothelial cell growth factor 165 receptor 2;VEGF165R2
Weitere Details:: This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells.

Versandbedingungen:: Blue Ice