Lif Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25755
Anwendung:: ELISA, WB
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Uniprot:: P09056
Synonyme:: CDF;cholinergic differentiation factor;D factor;DIA;differentiation inhibitory activity;differentiation-inducing factor;differentiation-stimulating factor;hepatocyte-stimulating factor III;HILDA;human interleukin in DA cells;leukemia inhibitory factor;melanoma-derived LPL inhibitor;MLPLI;myeloid leukaemia inhibitory factor
Weitere Details:: Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development; generation of neurons; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; cranium; early conceptus; and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine).