MEK6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2575
Zusätzliche Namen:: MAPKK6|MEK6|MKK6|PRKMK6|SAPKK-3|SAPKK3
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 37 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Uniprot:: P52564
Synonyme:: dual specificity mitogen-activated protein kinase kinase 6;MAPK/ERK kinase 6;MAPKK 6;MAPKK6;MEK 6;MEK6;MKK6;PRKMK6;protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6);SAPK kinase 3;SAPKK-3;SAPKK3;stress-activated protein kinase kinase 3
Weitere Details:: This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis.

Versandbedingungen:: Blue Ice