ABflo[R] 488 Rabbit anti-Human CD370/CLEC9A monoclonal antibody

Größe

Auf Anfrage

SKU:: A25734
Zusätzliche Namen:: CD370|DNGR-1|DNGR1|UNQ9341
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SSPCPNNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSPSPGLLPAERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSSV
Uniprot:: Q6UXN8
Synonyme:: C-type lectin domain family 9 member A;CD370;DNGR-1;DNGR1;HEEE9341;UNQ9341
Weitere Details:: CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells.