PE Rabbit anti-Mouse CD366/TIM-3/HAVCR2 monoclonal antibody

Größe

Auf Anfrage

SKU:: A25729
Zusätzliche Namen:: TIM-3|Tim3|Timd3
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
Uniprot:: Q8VIM0
Synonyme:: CD366;HAVcr-2;hepatitis A virus cellular receptor 2;hepatitis A virus cellular receptor 2 homolog;kidney injury molecule-3;KIM-3;SPTCL;T cell immunoglobulin mucin 3;T-cell immunoglobulin and mucin domain containing 3;T-cell immunoglobulin and mucin domain-containing protein 3;T-cell immunoglobulin mucin family member 3;T-cell immunoglobulin mucin receptor 3;T-cell membrane protein 3;Tim;TIM-;Tim-3;TIM3;Timd;TIMD-3;TIMD3
Weitere Details:: Predicted to enable metal ion binding activity. Involved in several processes, including regulation of cytokine production; regulation of leukocyte activation; and toll-like receptor signaling pathway. Located in cell surface; early endosome; and immunological synapse. Is expressed in several structures, including dorsal aorta; gut; liver; lung; and reproductive system. Human ortholog(s) of this gene implicated in hepatocellular carcinoma and renal cell carcinoma. Orthologous to human HAVCR2 (hepatitis A virus cellular receptor 2).

Versandbedingungen:: Blue Ice