[KD Validated] UHRF1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A25717
Zusätzliche Namen:: hNP95|hUHRF1|huNp95|ICBP90|Np95|RNF106|TDRD22
Anwendung:: ELISA, WB
Molekulargewicht:: 96kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Uniprot:: Q96T88
Synonyme:: E3 ubiquitin-protein ligase UHRF1;hNP95;hUHRF1;huNp95;ICBP90;inverted CCAAT box-binding protein of 90 kDa;Np95;nuclear phosphoprotein 95;nuclear protein 95;nuclear zinc finger protein Np95;RING finger protein 106;RING-type E3 ubiquitin transferase UHRF1;RNF106;TDRD22;transcription factor ICBP90;ubiquitin-like PHD and RING finger domain-containing protein 1;Ubiquitin-like-containing PHD and RING finger domains protein 1
Weitere Details:: This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12.

Versandbedingungen:: Blue Ice