PE Rabbit anti-Mouse/Rat CD27 monoclonal antibody

Größe

Auf Anfrage

SKU:: A25696
Zusätzliche Namen:: S152|Tnfrsf7|Tp55
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR
Uniprot:: P41272
Synonyme:: CD antigen 27;CD27 antigen;CD27L receptor;S15;S152;S152. LPFS2;T cell activation antigen S152;T-cell activation antigen CD27;T14;Tnfr;TNFRSF7;Tp5;Tp55;tumor necrosis factor receptor superfamily member 7;tumor necrosis factor receptor superfamily, member 7
Weitere Details:: Predicted to enable cysteine-type endopeptidase inhibitor activity involved in apoptotic process. Involved in negative regulation of apoptotic process and positive regulation of JNK cascade. Acts upstream of or within negative regulation of T cell apoptotic process. Located in external side of plasma membrane. Is expressed in several structures, including femur; hemolymphoid system; intestine; pituitary gland; and reproductive system. Human ortholog(s) of this gene implicated in lymphoproliferative syndrome 2. Orthologous to human CD27 (CD27 molecule).