SREBF2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25685
Zusätzliche Namen:: bHLHd2|SREBP-2|SREBP2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLTFLCLSFNPLTSL
Uniprot:: Q12772
Synonyme:: bHLHd2;class D basic helix-loop-helix protein 2;SREBP-2;SREBP2;sterol regulatory element-binding protein 2;Sterol regulatory element-binding transcription factor 2
Weitere Details:: This gene encodes a member of the a ubiquitously expressed transcription factor that controls cholesterol homeostasis by regulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain and binds the sterol regulatory element 1 motif. Alternate splicing results in multiple transcript variants.