SKP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2566
Zusätzliche Namen:: EMC19|OCP-II|OCP2|p19A|SKP1|SKP1A|TCEB1L
Anwendung:: ELISA, WB
Molekulargewicht:: 19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Uniprot:: P63208
Synonyme:: cyclin A/CDK2-associated p19;cyclin-A/CDK2-associated protein p19;EMC19;OCP-2;OCP-II;OCP2;organ of Corti protein 2;organ of Corti protein II;p19A;p19skp1;RNA polymerase II elongation factor-like protein;RNA polymerase II elongation factor-like protein OCP2;S-phase kinase-associated protein 1;SIII;SKP1A;TCEB1L;transcription elongation factor B polypeptide 1-like
Weitere Details:: This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7.

Versandbedingungen:: Blue Ice