FSH alpha/beta Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25649
Zusätzliche Namen:: CG-ALPHA|FSHA|FSHB|GPA1|GPHa|GPHA1|HCG|LHA|TSHA
Anwendung:: ELISA, IHC-P, IF
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant fusion protein containing a sequence corresponding to amino acids 25-116 of human FSH alpha/beta(NP_000726.1/NP_000501.1).
Formulierung:: Unmodified
Sequenz:: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Uniprot:: P01215, P01225
Synonyme:: anterior pituitary glycoprotein hormones common subunit alpha;CG-ALPHA;choriogonadotropin alpha chain;chorionic gonadotrophin subunit alpha;chorionic gonadotropin, alpha polypeptide;follicle stimulating hormone beta subunit;follicle stimulating hormone, beta polypeptide;follicle-stimulating hormone alpha chain;follicle-stimulating hormone alpha subunit;Follicle-stimulating hormone beta subunit;follitropin alpha chain;Follitropin beta chain;follitropin subunit beta;follitropin, beta chain;FSH-alpha;FSH-B;FSH-beta;FSHA;glycoprotein hormones alpha chain;GPA1;GPHa;GPHA1;HCG;HH24;LHA;LSH-alpha;luteinizing hormone alpha chain;lutropin alpha chain;thyroid-stimulating hormone alpha chain;thyrotropin alpha chain;TSH-alpha;TSHA
Weitere Details:: The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice