A25648
RXRB Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A25648
- Zusätzliche Namen:
- DAUDI6|H-2RIIBP|NR2B2|RCoR-1|RXR-beta|RXRbeta
- Anwendung:
- ChIP, ELISA, WB, IP
- Molekulargewicht:
- 72 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSP
- Uniprot:
- P28702
- Synonyme:
- DAUDI6;H-2RIIBP;MHC class I promoter binding protein;NR2B2;nuclear receptor subfamily 2 group B member 2;RCoR-1;retinoic acid receptor RXR-beta;Retinoid X receptor beta
- Weitere Details:
- This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice