[KD Validated] Argonaute-2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25642
Zusätzliche Namen:: CASC7|EIF2C2|LESKRES|LINC00980|PPD|Q10
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 97kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWF
Uniprot:: Q9UKV8
Synonyme:: argonaute 2, RISC catalytic component;Argonaute RISC catalytic component 2;cancer susceptibility candidate 7 (non-protein coding);CASC7;EIF2C2;Eukaryotic translation initiation factor 2C 2;eukaryotic translation initiation factor 2C, 2;LESKRES;LINC00980;long intergenic non-protein coding RNA 980;PAZ Piwi domain protein;PPD;protein argonaute-2;protein slicer;Q10
Weitere Details:: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.