[KO Validated] MLH1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25641
Zusätzliche Namen:: COCA2|FCC2|hMLH1|HNPCC|HNPCC2|LYNCH2|MLH-1|MMRCS1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 85 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGD
Uniprot:: P40692
Synonyme:: COCA2;DNA mismatch repair protein Mlh1;FCC2;hMLH1;HNPCC;HNPCC2;MMRCS1;mutL homolog 1, colon cancer, nonpolyposis type 2;MutL protein homolog 1
Weitere Details:: The protein encoded by this gene can heterodimerize with mismatch repair endonuclease PMS2 to form MutL alpha, part of the DNA mismatch repair system. When MutL alpha is bound by MutS beta and some accessory proteins, the PMS2 subunit of MutL alpha introduces a single-strand break near DNA mismatches, providing an entry point for exonuclease degradation. The encoded protein is also involved in DNA damage signaling and can heterodimerize with DNA mismatch repair protein MLH3 to form MutL gamma, which is involved in meiosis. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC).