14-3-3 Theta Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2563
Zusätzliche Namen:: 14-3-3|14-3-3 Theta|1C5|HS1
Anwendung:: ELISA, WB
Molekulargewicht:: 32kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAY
Uniprot:: P27348
Synonyme:: 14-3-3;14-3-3 protein T-cell;14-3-3 protein tau;14-3-3 protein theta;14-3-3 theta;1C5;HS1;Protein HS1;protein, theta;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
Weitere Details:: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.