TGF beta induced (TGFBI) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2561
Zusätzliche Namen:: BIGH3|CDB1|CDG2|CDGG1|CSD|CSD1|CSD2|CSD3|EBMD|LCD1|TGF beta induced (TGFBI)
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LPPRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
Uniprot:: Q15582
Synonyme:: beta ig-h3;betaig-h3;BIGH3;CDB1;CDG2;CDGG1;CSD;CSD1;CSD2;CSD3;EBMD;kerato-epithelin;LCD1;RGD-CAP;RGD-containing collagen-associated protein;transforming growth factor beta-induced 68kDa;transforming growth factor-beta-induced protein ig-h3;transforming growth factor, beta-induced, 68kD
Weitere Details:: This gene encodes an RGD-containing protein that binds to type I, II and IV collagens. The RGD motif is found in many extracellular matrix proteins modulating cell adhesion and serves as a ligand recognition sequence for several integrins. This protein plays a role in cell-collagen interactions and may be involved in endochondrial bone formation in cartilage. The protein is induced by transforming growth factor-beta and acts to inhibit cell adhesion. Mutations in this gene are associated with multiple types of corneal dystrophy.

Versandbedingungen:: Blue Ice