L1R Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A25603
Anwendung:: ELISA, WB
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Virus
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Spezies:: Virus
Sequenz:: MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEQ
Uniprot:: Q8V4Z7
Synonyme:: IMV membrane protein J1;MPXV_gp080
Weitere Details:: At present, the study of monkeypox L1 R protein has not been reported. However, studies have shown that vaccinia virus J1R is a membrane protein required for virus growth and plaque formation, and plays a role in the formation of immature virus particles.