YBEY Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25601
Zusätzliche Namen:: C21orf57
Anwendung:: ELISA, WB
Molekulargewicht:: 19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FHEHLKAGEFPQPDFPDDYNLGDIFLGVEYIFHQCKENEDYNDVLTVTATHGLCHLLGFTHGTEAEWQQMFQKEKAVLDELGRRTGTRLQPLTRGLFGGS
Uniprot:: P58557
Synonyme:: C21orf57;endoribonuclease YbeY;putative metalloprotease C21orf57;putative ribonuclease;rRNA maturation factor homolog;ybeY metallopeptidase (putative)
Weitere Details:: This gene encodes a highly conserved metalloprotein. A similar protein in bacteria acts as an endoribonuclease, and is thought to function in ribosomal RNA maturation and ribosome assembly. Alternative splicing results in multiple transcript variants.