RACK1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2560
Zusätzliche Namen:: Gnb2-rs1|GNB2L1|H12.3|HLC-7|PIG21|RACK1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 32 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLA
Uniprot:: P63244
Synonyme:: cell proliferation-inducing gene 21 protein;Gnb2-rs1;GNB2L1;guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1;guanine nucleotide binding protein beta polypeptide 2-like 1;guanine nucleotide-binding protein subunit beta-2-like 1;guanine nucleotide-binding protein subunit beta-like protein 12.3;H12.3;HLC-7;human lung cancer oncogene 7 protein;lung cancer oncogene 7;PIG21;proliferation-inducing gene 21;protein homologous to chicken B complex protein, guanine nucleotide binding;Receptor for activated C kinase;receptor of activated protein C kinase 1;receptor of activated protein kinase C 1;small ribosomal subunit protein RACK1
Weitere Details:: Enables several functions, including cyclin binding activity; enzyme binding activity; and protein domain specific binding activity. Involved in several processes, including positive regulation of hydrolase activity; regulation of cellular protein metabolic process; and regulation of signal transduction. Located in several cellular components, including midbody; perinuclear region of cytoplasm; and phagocytic cup. Part of IRE1-RACK1-PP2A complex.

Versandbedingungen:: Blue Ice