PLIN5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25598
Zusätzliche Namen:: LSDA5|LSDP5|MLDP|OXPAT
Anwendung:: ELISA, WB
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHAHACVDELLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIG
Uniprot:: Q00G26
Synonyme:: lipid storage droplet protein 5;LSDA5;LSDP5;MLDP;OXPAT;perilipin-5
Weitere Details:: Predicted to enable identical protein binding activity and lipase binding activity. Predicted to be involved in several processes, including negative regulation of peroxisome proliferator activated receptor signaling pathway; regulation of lipase activity; and regulation of lipid metabolic process. Located in intracellular membrane-bounded organelle and lipid droplet.