A25585
GLDC Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A25585
- Zusätzliche Namen:
- GCE|GCSP|HYGN1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 113kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSH
- Uniprot:
- P23378
- Synonyme:
- GCE;GCSP;Glycine cleavage system P protein;glycine cleavage system protein P;Glycine decarboxylase;glycine decarboxylase P-protein;glycine dehydrogenase (aminomethyl-transferring);glycine dehydrogenase (decarboxylating), mitochondrial;glycine dehydrogenase [decarboxylating], mitochondrial;HYGN1;nonketotic hyperglycinemia
- Weitere Details:
- Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the P protein, which binds to glycine and enables the methylamine group from glycine to be transferred to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH).
- Versandbedingungen:
- Blue Ice