Granzyme B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2557
Zusätzliche Namen:: C11|CCPI|CGL-1|CGL1|CSP-B|CSPB|CTLA1|CTSGL1|Granzyme B|HLP|SECT
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFK
Uniprot:: P10144
Synonyme:: C11;cathepsin G-like 1;CCPI;CGL-1;CGL1;CSP-B;CSPB;CTLA-1;CTLA1;CTSGL1;cytotoxic serine protease B;cytotoxic T-lymphocyte proteinase 2;fragmentin 2;Fragmentin-2;granzyme B;granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1);Granzyme-2;HLP;human lymphocyte protein;SECT;T-cell serine protease 1-3E
Weitere Details:: This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis.

Versandbedingungen:: Blue Ice