ABflo[R] 647 Rabbit anti-Mouse CD205/DEC-205 monoclonal antibody

Größe

Auf Anfrage

SKU:: A25531
Zusätzliche Namen:: CD205|DEC-205|DEC205
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CEGNWEKNEQIGSCYQFNNQEILSWKEAYVSCQNQGADLLSIHSAAELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFLNWDPGTPVAPVIGGSSCARMDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTHCHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKEIWTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLGKLGQWKVQSCEKKLRYVCKKKGE
Uniprot:: Q60767
Synonyme:: C-type lectin domain family 13 member B;CD205;CLEC13B;DEC-205;DEC-205/DCL-1 fusion;DEC205;gp200-MR6;ly-75;LY75;LY75-CD302 fusion protein;lymphocyte antigen 75
Weitere Details:: Predicted to enable signaling receptor activity. Predicted to act upstream of or within endocytosis. Located in external side of plasma membrane. Is expressed in thymus and thymus primordium. Orthologous to several human genes including LY75-CD302 (LY75-CD302 readthrough).